Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451 |
Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families) Pfam PF00581 the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology |
Family c.46.1.2: Multidomain sulfurtransferase (rhodanese) [52827] (4 proteins) duplication: consists of two domains of this fold |
Protein 3-mercaptopyruvate sulfurtransferase [102427] (2 species) |
Species Escherichia coli [TaxId:562] [102429] (1 PDB entry) |
Domain d1urha1: 1urh A:2-148 [99829] complexed with so3 |
PDB Entry: 1urh (more details), 2.8 Å
SCOPe Domain Sequences for d1urha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} ttwfvgadwlaehiddpeiqiidarmaspgqedrnvaqeylnghipgavffdiealsdht splphmlprpetfavamrelgvnqdkhlivydegnlfsaprawwmlrtfgvekvsilggg lagwqrddllleegavelpegefnaaf
Timeline for d1urha1: