SCOPe 2.04: Domain d1ur3m_: 1ur3 M:

Lineage for d1ur3m_ (1ur3 M:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
   Common fold covers whole protein structure

6. Protein Hypothetical oxidoreductase YdhF [89459] (1 species)

7. Species Escherichia coli [TaxId:562] [89460] (2 PDB entries)

8. Domain d1ur3m_: 1ur3 M: [99806]
   apo form
   complexed with so4

Details for d1ur3m_

PDB Entry: 1ur3, 2.57 Å

PDB Description: crystal structure of the apo form of the e.coli ydhf protein

PDB Compounds: (M:) hypothetical oxidoreductase ydhf

SCOPe Domain Sequences for d1ur3m_:

Sequence; same for both SEQRES and ATOM records:

>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]}
lvqritiapqgpefsrfvmgywrlmdwnmsarqlvsfieehldlgvttvdhadiyggyqc
eaafgealklaphlrermeivskcgiattareenvighyitdrdhiiksaeqslinlatd
hldlllihrpdplmdadevadafkhlhqsgkvrhfgvsnftpaqfallqsrlpftlatnq
veispvhqpllldgtldqlqqlrvrpmawsclgggrlfnddyfqplrdelavvaeelnag
sieqvvnawvlrlpsqplpiigsgkiervraaveaetlkmtrqqwfrirkaalgydvp

Timeline for d1ur3m_:

• d1ur3m_ first appeared in SCOP 1.67
  
• d1ur3m_ appears in SCOPe 2.03
  
• d1ur3m_ appears in SCOPe 2.05
  
• d1ur3m_ appears in the current release, SCOPe 2.08