Lineage for d1ur3m_ (1ur3 M:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568069Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 1568070Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 1568257Protein Hypothetical oxidoreductase YdhF [89459] (1 species)
  7. 1568258Species Escherichia coli [TaxId:562] [89460] (2 PDB entries)
  8. 1568259Domain d1ur3m_: 1ur3 M: [99806]
    apo form
    complexed with so4

Details for d1ur3m_

PDB Entry: 1ur3 (more details), 2.57 Å

PDB Description: crystal structure of the apo form of the e.coli ydhf protein
PDB Compounds: (M:) hypothetical oxidoreductase ydhf

SCOPe Domain Sequences for d1ur3m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]}
lvqritiapqgpefsrfvmgywrlmdwnmsarqlvsfieehldlgvttvdhadiyggyqc
eaafgealklaphlrermeivskcgiattareenvighyitdrdhiiksaeqslinlatd
hldlllihrpdplmdadevadafkhlhqsgkvrhfgvsnftpaqfallqsrlpftlatnq
veispvhqpllldgtldqlqqlrvrpmawsclgggrlfnddyfqplrdelavvaeelnag
sieqvvnawvlrlpsqplpiigsgkiervraaveaetlkmtrqqwfrirkaalgydvp

SCOPe Domain Coordinates for d1ur3m_:

Click to download the PDB-style file with coordinates for d1ur3m_.
(The format of our PDB-style files is described here.)

Timeline for d1ur3m_: