| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology automatically mapped to Pfam PF02776 |
| Protein Carboxyethylarginine synthase [102330] (1 species) |
| Species Streptomyces clavuligerus [TaxId:1901] [102331] (6 PDB entries) |
| Domain d1upac2: 1upa C:12-197 [99721] Other proteins in same PDB: d1upaa1, d1upaa3, d1upab1, d1upab3, d1upac1, d1upac3, d1upad1, d1upad3 complexed with mg, so4, tpp |
PDB Entry: 1upa (more details), 2.35 Å
SCOPe Domain Sequences for d1upac2:
Sequence, based on SEQRES records: (download)
>d1upac2 c.36.1.5 (C:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]}
ptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlarit
grpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaivap
mskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidttvpnppantp
akpvgv
>d1upac2 c.36.1.5 (C:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]}
ptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlarit
grpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaivap
mskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidppantpakpvg
v
Timeline for d1upac2: