Lineage for d1upac2 (1upa C:12-197)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393047Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 393048Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 393049Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (7 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
  6. 393075Protein Carboxyethylarginine synthase [102330] (1 species)
  7. 393076Species Streptomyces clavuligerus [TaxId:1901] [102331] (3 PDB entries)
  8. 393079Domain d1upac2: 1upa C:12-197 [99721]
    Other proteins in same PDB: d1upaa1, d1upaa3, d1upab1, d1upab3, d1upac1, d1upac3, d1upad1, d1upad3

Details for d1upac2

PDB Entry: 1upa (more details), 2.35 Å

PDB Description: carboxyethylarginine synthase from streptomyces clavuligerus (semet structure)

SCOP Domain Sequences for d1upac2:

Sequence, based on SEQRES records: (download)

>d1upac2 c.36.1.5 (C:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus}
ptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlarit
grpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaivap
mskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidttvpnppantp
akpvgv

Sequence, based on observed residues (ATOM records): (download)

>d1upac2 c.36.1.5 (C:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus}
ptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlarit
grpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaivap
mskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidppantpakpvg
v

SCOP Domain Coordinates for d1upac2:

Click to download the PDB-style file with coordinates for d1upac2.
(The format of our PDB-style files is described here.)

Timeline for d1upac2: