Lineage for d1uoua1 (1uou A:33-100)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642273Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
    4 helices; bundle, left-handed twist; right-handed superhelix
  4. 642282Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (1 family) (S)
  5. 642283Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)
  6. 642320Protein Thymidine phosphorylase [47650] (2 species)
  7. 642327Species Human (Homo sapiens) [TaxId:9606] [101212] (1 PDB entry)
  8. 642328Domain d1uoua1: 1uou A:33-100 [99706]
    Other proteins in same PDB: d1uoua2, d1uoua3
    complexed with cmu

Details for d1uoua1

PDB Entry: 1uou (more details), 2.11 Å

PDB Description: crystal structure of human thymidine phosphorylase in complex with a small molecule inhibitor
PDB Compounds: (A:) thymidine phosphorylase

SCOP Domain Sequences for d1uoua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uoua1 a.46.2.1 (A:33-100) Thymidine phosphorylase {Human (Homo sapiens) [TaxId: 9606]}
pkqlpelirmkrdggrlseadirgfvaavvngsaqgaqigamlmairlrgmdleetsvlt
qalaqsgq

SCOP Domain Coordinates for d1uoua1:

Click to download the PDB-style file with coordinates for d1uoua1.
(The format of our PDB-style files is described here.)

Timeline for d1uoua1: