![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.46: Methionine synthase domain-like [47643] (2 superfamilies) 4 helices; bundle, left-handed twist; right-handed superhelix |
![]() | Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (1 family) ![]() |
![]() | Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins) |
![]() | Protein Thymidine phosphorylase [47650] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101212] (1 PDB entry) |
![]() | Domain d1uoua1: 1uou A:33-100 [99706] Other proteins in same PDB: d1uoua2, d1uoua3 complexed with cmu |
PDB Entry: 1uou (more details), 2.11 Å
SCOP Domain Sequences for d1uoua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uoua1 a.46.2.1 (A:33-100) Thymidine phosphorylase {Human (Homo sapiens)} pkqlpelirmkrdggrlseadirgfvaavvngsaqgaqigamlmairlrgmdleetsvlt qalaqsgq
Timeline for d1uoua1: