SCOP 1.75: Domain d1uooa2: 1uoo A:431-710

Lineage for d1uooa2 (1uoo A:431-710)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.4: Prolyl oligopeptidase, C-terminal domain [53496] (1 protein)
   N-terminal domain is a 7-bladed beta-propeller

6. Protein Prolyl oligopeptidase, C-terminal domain [53497] (1 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [53498] (16 PDB entries)
   Uniprot P23687

8. Domain d1uooa2: 1uoo A:431-710 [99699]
   Other proteins in same PDB: d1uooa1
   complexed with gol; mutant

Details for d1uooa2

PDB Entry: 1uoo, 2.35 Å

PDB Description: prolyl oligopeptidase from porcine brain, s554a mutant with bound peptide ligand gly-phe-arg-pro

PDB Compounds: (A:) prolyl endopeptidase

SCOP Domain Sequences for d1uooa2:

Sequence; same for both SEQRES and ATOM records:

>d1uooa2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
dasdyqtvqifypskdgtkipmfivhkkgikldgshpaflygyggfnisitpnysvsrli
fvrhmggvlavanirgggeygetwhkggilankqncfddfqcaaeylikegytspkrlti
ngganggllvatcanqrpdlfgcviaqvgvmdmlkfhkytighawttdygcsdskqhfew
likysplhnvklpeaddiqypsmllltadhddrvvplhslkfiatlqyivgrsrkqnnpl
lihvdtkaghgagkptakvieevsdmfafiarclnidwip

Timeline for d1uooa2:

• d1uooa2 first appeared in SCOP 1.67
  
• d1uooa2 appears in SCOP 1.73
  
• d1uooa2 appears in SCOPe 2.01
  
• d1uooa2 appears in the current release, SCOPe 2.08