SCOPe 2.06: Domain d1un6c3: 1un6 C:161-190

Lineage for d1un6c3 (1un6 C:161-190)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
   simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC

4. Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families)

5. Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)

6. Protein Transcription factor IIIA, TFIIIA [57693] (1 species)
   duplication: consists of 6 fingers
7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [57694] (4 PDB entries)

8. Domain d1un6c3: 1un6 C:161-190 [99654]
   protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d1un6c3

PDB Entry: 1un6, 3.1 Å

PDB Description: the crystal structure of a zinc finger - rna complex reveals two modes of molecular recognition

PDB Compounds: (C:) transcription factor iiia

SCOPe Domain Sequences for d1un6c3:

Sequence; same for both SEQRES and ATOM records:

>d1un6c3 g.37.1.1 (C:161-190) Transcription factor IIIA, TFIIIA {African clawed frog (Xenopus laevis) [TaxId: 8355]}
gypckkddscsfvgktwtlylkhvaechqd

Timeline for d1un6c3:

• d1un6c3 first appeared in SCOP 1.67
  
• d1un6c3 appears in SCOPe 2.05
  
• d1un6c3 appears in SCOPe 2.07
  
• d1un6c3 appears in the current release, SCOPe 2.08