Lineage for d1umzb_ (1umz B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2050469Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (7 proteins)
    Pfam PF00722
    beta-Glucanase-like
  6. 2050547Protein Xyloglucan endotransglycosylase [101634] (1 species)
  7. 2050548Species European aspen (Populus tremula) [TaxId:113636] [101635] (2 PDB entries)
  8. 2050550Domain d1umzb_: 1umz B: [99640]

Details for d1umzb_

PDB Entry: 1umz (more details), 1.8 Å

PDB Description: xyloglucan endotransglycosylase in complex with the xyloglucan nonasaccharide xllg.
PDB Compounds: (B:) xyloglucan endotransglycosylase

SCOPe Domain Sequences for d1umzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1umzb_ b.29.1.2 (B:) Xyloglucan endotransglycosylase {European aspen (Populus tremula) [TaxId: 113636]}
vafgrnyvptwafdhikyfnggneiqlhldkytgtgfqskgsylfghfsmqmklvpgdsa
gtvtafylssqnsehdeidfeflgnrtgqpyilqtnvftggkgdreqriylwfdptkefh
yysvlwnmymivflvddvpirvfknckdlgvkfpfnqpmkiysslwnaddwatrgglekt
dwskapfiasyrsfhidgceasveakfcatqgarwwdqkefqdldafqyrrlswvrqkyt
iynyctdrsrypsmppeckrdrdi

SCOPe Domain Coordinates for d1umzb_:

Click to download the PDB-style file with coordinates for d1umzb_.
(The format of our PDB-style files is described here.)

Timeline for d1umzb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1umza_