| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.223: Polo-box domain [82614] (1 superfamily) beta(6)-alpha; antiparallel beta-sheet, meander |
Superfamily d.223.1: Polo-box domain [82615] (2 families) ![]() Serine/threonine protein kinase-associated motif embedded in two distinct folds |
| Family d.223.1.2: Polo-box duplicated region [102856] (1 protein) duplication: consists of two polo-box domains; binds phosphothreonine peptide |
| Protein Serine/threonine-protein kinase plk C-terminal domain [102857] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [102858] (6 PDB entries) |
| Domain d1umwb1: 1umw B:373-500 [99633] |
PDB Entry: 1umw (more details), 1.9 Å
SCOPe Domain Sequences for d1umwb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1umwb1 d.223.1.2 (B:373-500) Serine/threonine-protein kinase plk C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
hlsdmlqqlhsvnaskpserglvrqeeaedpacipifwvskwvdysdkyglgyqlcdnsv
gvlfndstrlilyndgdslqyierdgtesyltvsshpnslmkkitllkyfrnymsehllk
aganitpr
Timeline for d1umwb1: