Lineage for d1umcd2 (1umc D:188-324)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1370884Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 1370885Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 1370937Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (4 proteins)
    automatically mapped to Pfam PF02780
  6. 1370945Protein Branched-chain alpha-keto acid dehydrogenase [52927] (2 species)
  7. 1370970Species Thermus thermophilus [TaxId:274] [102468] (4 PDB entries)
  8. 1370978Domain d1umcd2: 1umc D:188-324 [99598]
    Other proteins in same PDB: d1umca_, d1umcb1, d1umcc_, d1umcd1
    complexed with 4mv, mg, tdp

Details for d1umcd2

PDB Entry: 1umc (more details), 2.4 Å

PDB Description: branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methylpentanoate
PDB Compounds: (D:) 2-oxo acid dehydrogenase beta subunit

SCOPe Domain Sequences for d1umcd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1umcd2 c.48.1.2 (D:188-324) Branched-chain alpha-keto acid dehydrogenase {Thermus thermophilus [TaxId: 274]}
dytlpigkaalrregkdltlicygtvmpevlqaaaelakagvsaevldlrtlmpwdyeav
mnsvaktgrvvlvsdaprhasfvsevaatiaedlldmllappirvtgfdtpypyaqdkly
lptvtrilnaakraldy

SCOPe Domain Coordinates for d1umcd2:

Click to download the PDB-style file with coordinates for d1umcd2.
(The format of our PDB-style files is described here.)

Timeline for d1umcd2: