Lineage for d1umcd1 (1umc D:2-187)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162387Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1162388Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1162582Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (4 proteins)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
  6. 1162590Protein Branched-chain alpha-keto acid dehydrogenase, Pyr module [88742] (2 species)
  7. 1162613Species Thermus thermophilus [TaxId:274] [102332] (4 PDB entries)
  8. 1162621Domain d1umcd1: 1umc D:2-187 [99597]
    Other proteins in same PDB: d1umca_, d1umcb2, d1umcc_, d1umcd2
    complexed with 4mv, mg, tdp

Details for d1umcd1

PDB Entry: 1umc (more details), 2.4 Å

PDB Description: branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methylpentanoate
PDB Compounds: (D:) 2-oxo acid dehydrogenase beta subunit

SCOPe Domain Sequences for d1umcd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1umcd1 c.36.1.7 (D:2-187) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Thermus thermophilus [TaxId: 274]}
almtmvqalnraldeemakdprvvvlgedvgkrggvflvtegllqkygpdrvmdtplsea
aivgaalgmaahglrpvaeiqfadyifpgfdqlvsqvaklryrsggqftaplvvrmpsgg
gvrgghhhsqspeahfvhtaglkvvavstpydakgllkaairdedpvvflepkrlyrsvk
eevpee

SCOPe Domain Coordinates for d1umcd1:

Click to download the PDB-style file with coordinates for d1umcd1.
(The format of our PDB-style files is described here.)

Timeline for d1umcd1: