![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (5 proteins) parent family to TK and PFOR heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module automatically mapped to Pfam PF02779 |
![]() | Protein Branched-chain alpha-keto acid dehydrogenase, Pyr module [88742] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [102332] (4 PDB entries) |
![]() | Domain d1umbb1: 1umb B:2-187 [99588] Other proteins in same PDB: d1umba_, d1umbb2, d1umbc_, d1umbd2 complexed with mg, tdp |
PDB Entry: 1umb (more details), 2.1 Å
SCOPe Domain Sequences for d1umbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1umbb1 c.36.1.7 (B:2-187) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Thermus thermophilus [TaxId: 274]} almtmvqalnraldeemakdprvvvlgedvgkrggvflvtegllqkygpdrvmdtplsea aivgaalgmaahglrpvaeiqfadyifpgfdqlvsqvaklryrsggqftaplvvrmpsgg gvrgghhhsqspeahfvhtaglkvvavstpydakgllkaairdedpvvflepkrlyrsvk eevpee
Timeline for d1umbb1:
![]() Domains from other chains: (mouse over for more information) d1umba_, d1umbc_, d1umbd1, d1umbd2 |