Lineage for d1ulka2 (1ulk A:43-83)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2634701Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (3 families) (S)
  5. 2634702Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (7 proteins)
  6. 2634731Protein Lectin-C [103522] (1 species)
    consists of three homologous domains
  7. 2634732Species American pokeweed (Phytolacca americana) [TaxId:3527] [103523] (1 PDB entry)
  8. 2634734Domain d1ulka2: 1ulk A:43-83 [99560]

Details for d1ulka2

PDB Entry: 1ulk (more details), 1.8 Å

PDB Description: Crystal Structure of Pokeweed Lectin-C
PDB Compounds: (A:) lectin-C

SCOPe Domain Sequences for d1ulka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulka2 g.3.1.1 (A:43-83) Lectin-C {American pokeweed (Phytolacca americana) [TaxId: 3527]}
nrcgkefggkechdelccsqygwcgnsdghcgegcqsqcsy

SCOPe Domain Coordinates for d1ulka2:

Click to download the PDB-style file with coordinates for d1ulka2.
(The format of our PDB-style files is described here.)

Timeline for d1ulka2: