Lineage for d1ul9a_ (1ul9 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1307103Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1307104Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1307849Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 1307928Protein Galectin-2 [101639] (1 species)
  7. 1307929Species Inky cap fungus (Coprinopsis cinerea) [TaxId:5346] [101640] (6 PDB entries)
  8. 1307936Domain d1ul9a_: 1ul9 A: [99541]

Details for d1ul9a_

PDB Entry: 1ul9 (more details), 2.22 Å

PDB Description: CGL2 ligandfree
PDB Compounds: (A:) galectin-2

SCOPe Domain Sequences for d1ul9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ul9a_ b.29.1.3 (A:) Galectin-2 {Inky cap fungus (Coprinopsis cinerea) [TaxId: 5346]}
mlyhlfvnnqvklqndfkpesvaairssafnskggttvfnflsagenillhisirpgenv
ivfnsrlkngawgpeeripyaekfrppnpsitvidhgdrfqirfdygtsiyynkrikena
aaiaynaenslfsspvtvdvhgllpplppa

SCOPe Domain Coordinates for d1ul9a_:

Click to download the PDB-style file with coordinates for d1ul9a_.
(The format of our PDB-style files is described here.)

Timeline for d1ul9a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ul9b_