SCOP 1.67: Domain d1ul9a_: 1ul9 A:

Lineage for d1ul9a_ (1ul9 A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (8 proteins)

6. Protein Galectin-2 [101639] (1 species)

7. Species Inky cap fungus (Coprinopsis cinerea) [TaxId:5346] [101640] (6 PDB entries)

8. Domain d1ul9a_: 1ul9 A: [99541]

Details for d1ul9a_

PDB Entry: 1ul9, 2.22 Å

PDB Description: CGL2 ligandfree

SCOP Domain Sequences for d1ul9a_:

Sequence; same for both SEQRES and ATOM records:

>d1ul9a_ b.29.1.3 (A:) Galectin-2 {Inky cap fungus (Coprinopsis cinerea)}
mlyhlfvnnqvklqndfkpesvaairssafnskggttvfnflsagenillhisirpgenv
ivfnsrlkngawgpeeripyaekfrppnpsitvidhgdrfqirfdygtsiyynkrikena
aaiaynaenslfsspvtvdvhgllpplppa

Timeline for d1ul9a_:

• d1ul9a_ is new in SCOP 1.67
  
• d1ul9a_ appears in SCOP 1.69
  
• d1ul9a_ appears in the current release, SCOPe 2.08