Lineage for d1ukga_ (1ukg A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1779938Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 1780101Protein Legume lectin [49904] (23 species)
  7. 1780105Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [82032] (9 PDB entries)
  8. 1780106Domain d1ukga_: 1ukg A: [99489]
    complexed with ca, mma, mn

Details for d1ukga_

PDB Entry: 1ukg (more details), 1.7 Å

PDB Description: pterocarps angolensis lectin pal in complex with methyl-alpha-mannose
PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d1ukga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]}
edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
a

SCOPe Domain Coordinates for d1ukga_:

Click to download the PDB-style file with coordinates for d1ukga_.
(The format of our PDB-style files is described here.)

Timeline for d1ukga_: