Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (11 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.10: Avirulence protein Avrpph3 [102723] (1 protein) |
Protein Avirulence protein Avrpph3 [102724] (1 species) |
Species Pseudomonas syringae pv. phaseolicola [TaxId:319] [102725] (1 PDB entry) |
Domain d1ukfa_: 1ukf A: [99488] |
PDB Entry: 1ukf (more details), 1.35 Å
SCOP Domain Sequences for d1ukfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ukfa_ d.3.1.10 (A:) Avirulence protein Avrpph3 {Pseudomonas syringae pv. phaseolicola} slsdfsvasrdvnhnnicaglstewlvmssdgdaesrmdhldyngegqsrgserhqvynd alraalsnddeapfftastaviedagfslrrepktvhasggsaqlgqtvahdvaqsgrkh llslrfanvqghaiacscegsqfklfdpnlgefqssrsaapqlikglidhynslnydvac vnefrvsv
Timeline for d1ukfa_: