SCOP 1.69: Domain d1ukfa_: 1ukf A:

Lineage for d1ukfa_ (1ukf A:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (11 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.10: Avirulence protein Avrpph3 [102723] (1 protein)

6. Protein Avirulence protein Avrpph3 [102724] (1 species)

7. Species Pseudomonas syringae pv. phaseolicola [TaxId:319] [102725] (1 PDB entry)

8. Domain d1ukfa_: 1ukf A: [99488]

Details for d1ukfa_

PDB Entry: 1ukf, 1.35 Å

PDB Description: Crystal Structure of Pseudomonas Avirulence Protein AvrPphB

SCOP Domain Sequences for d1ukfa_:

Sequence; same for both SEQRES and ATOM records:

>d1ukfa_ d.3.1.10 (A:) Avirulence protein Avrpph3 {Pseudomonas syringae pv. phaseolicola}
slsdfsvasrdvnhnnicaglstewlvmssdgdaesrmdhldyngegqsrgserhqvynd
alraalsnddeapfftastaviedagfslrrepktvhasggsaqlgqtvahdvaqsgrkh
llslrfanvqghaiacscegsqfklfdpnlgefqssrsaapqlikglidhynslnydvac
vnefrvsv

Timeline for d1ukfa_:

• d1ukfa_ first appeared in SCOP 1.67
  
• d1ukfa_ appears in SCOP 1.71
  
• d1ukfa_ appears in the current release, SCOPe 2.08, called d1ukfa1