![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.10: Avirulence protein Avrpph3 [102723] (1 protein) automatically mapped to Pfam PF03543 |
![]() | Protein Avirulence protein Avrpph3 [102724] (1 species) |
![]() | Species Pseudomonas syringae pv. phaseolicola [TaxId:319] [102725] (1 PDB entry) |
![]() | Domain d1ukfa1: 1ukf A:81-267 [99488] Other proteins in same PDB: d1ukfa2 |
PDB Entry: 1ukf (more details), 1.35 Å
SCOPe Domain Sequences for d1ukfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ukfa1 d.3.1.10 (A:81-267) Avirulence protein Avrpph3 {Pseudomonas syringae pv. phaseolicola [TaxId: 319]} slsdfsvasrdvnhnnicaglstewlvmssdgdaesrmdhldyngegqsrgserhqvynd alraalsnddeapfftastaviedagfslrrepktvhasggsaqlgqtvahdvaqsgrkh llslrfanvqghaiacscegsqfklfdpnlgefqssrsaapqlikglidhynslnydvac vnefrvs
Timeline for d1ukfa1: