SCOPe 2.08: Domain d1ukfa1: 1ukf A:81-267

Lineage for d1ukfa1 (1ukf A:81-267)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.10: Avirulence protein Avrpph3 [102723] (1 protein)
   automatically mapped to Pfam PF03543

6. Protein Avirulence protein Avrpph3 [102724] (1 species)

7. Species Pseudomonas syringae pv. phaseolicola [TaxId:319] [102725] (1 PDB entry)

8. Domain d1ukfa1: 1ukf A:81-267 [99488]
   Other proteins in same PDB: d1ukfa2

Details for d1ukfa1

PDB Entry: 1ukf, 1.35 Å

PDB Description: Crystal Structure of Pseudomonas Avirulence Protein AvrPphB

PDB Compounds: (A:) Avirulence protein AVRPPH3

SCOPe Domain Sequences for d1ukfa1:

Sequence; same for both SEQRES and ATOM records:

>d1ukfa1 d.3.1.10 (A:81-267) Avirulence protein Avrpph3 {Pseudomonas syringae pv. phaseolicola [TaxId: 319]}
slsdfsvasrdvnhnnicaglstewlvmssdgdaesrmdhldyngegqsrgserhqvynd
alraalsnddeapfftastaviedagfslrrepktvhasggsaqlgqtvahdvaqsgrkh
llslrfanvqghaiacscegsqfklfdpnlgefqssrsaapqlikglidhynslnydvac
vnefrvs

Timeline for d1ukfa1:

• d1ukfa1 first appeared in SCOP 1.67, called d1ukfa_
  
• d1ukfa1 appears in SCOPe 2.07