SCOP 1.75: Domain d1ujzb_: 1ujz B:

Lineage for d1ujzb_ (1ujz B:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
   core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures

4. Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families)
   common motif contains conserved histidine residue and metal-binding site

5. Family d.4.1.1: HNH-motif [54061] (2 proteins)

6. Protein DNase domain of colicin E7 [54062] (1 species)

7. Species Escherichia coli [TaxId:562] [54063] (8 PDB entries)

8. Domain d1ujzb_: 1ujz B: [99476]
   Other proteins in same PDB: d1ujza_
   computationally designed interface with the Im7 immunity protein
   mutant

Details for d1ujzb_

PDB Entry: 1ujz, 2.1 Å

PDB Description: crystal structure of the e7_c/im7_c complex; a computationally designed interface between the colicin e7 dnase and the im7 immunity protein

PDB Compounds: (B:) Designed Colicin E7 DNase

SCOP Domain Sequences for d1ujzb_:

Sequence; same for both SEQRES and ATOM records:

>d1ujzb_ d.4.1.1 (B:) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]}
rnkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskd
pelskqfsrnnndrmkvgkapqtrtqdvsgkrrsfelhhekpisqnggvydmdnisvvtp
kraidih

Timeline for d1ujzb_:

• d1ujzb_ first appeared in SCOP 1.67
  
• d1ujzb_ appears in SCOP 1.73
  
• d1ujzb_ appears in SCOPe 2.01
  
• d1ujzb_ appears in the current release, SCOPe 2.08