Lineage for d1ujzb_ (1ujz B:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 715661Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 715662Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 715663Family d.4.1.1: HNH-motif [54061] (2 proteins)
  6. 715664Protein DNase domain of colicin E7 [54062] (1 species)
  7. 715665Species Escherichia coli [TaxId:562] [54063] (6 PDB entries)
  8. 715671Domain d1ujzb_: 1ujz B: [99476]
    Other proteins in same PDB: d1ujza_
    computationally designed interface with the Im7 immunity protein
    mutant

Details for d1ujzb_

PDB Entry: 1ujz (more details), 2.1 Å

PDB Description: crystal structure of the e7_c/im7_c complex; a computationally designed interface between the colicin e7 dnase and the im7 immunity protein
PDB Compounds: (B:) Designed Colicin E7 DNase

SCOP Domain Sequences for d1ujzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ujzb_ d.4.1.1 (B:) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]}
rnkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskd
pelskqfsrnnndrmkvgkapqtrtqdvsgkrrsfelhhekpisqnggvydmdnisvvtp
kraidih

SCOP Domain Coordinates for d1ujzb_:

Click to download the PDB-style file with coordinates for d1ujzb_.
(The format of our PDB-style files is described here.)

Timeline for d1ujzb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ujza_