Lineage for d1uisa_ (1uis A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 600869Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 600870Superfamily d.22.1: GFP-like [54511] (2 families) (S)
  5. 600871Family d.22.1.1: Fluorescent proteins [54512] (5 proteins)
  6. 600962Protein Red fluorescent protein fp61 [102854] (1 species)
  7. 600963Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [102855] (1 PDB entry)
  8. 600964Domain d1uisa_: 1uis A: [99431]

Details for d1uisa_

PDB Entry: 1uis (more details), 2 Å

PDB Description: The 2.0 crystal structure of eqFP611, a far-red fluorescent protein from the sea anemone Entacmaea quadricolor

SCOP Domain Sequences for d1uisa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uisa_ d.22.1.1 (A:) Red fluorescent protein fp61 {Sea anemone (Entacmaea quadricolor)}
ihmnslikenmrmmvvmegsvngyqfkctgegdgnpymgtqtmrikvveggplpfafdil
atsfmsktfikhtkgipdffkqsfpegftwervtryedggvftvmqdtsledgclvyhak
vtgvnfpsngavmqkktkgwepntemlypadgglrgysqmalnvdgggylscsfettyrs
kktvenfkmpgfhfvdhrlerleesdkemfvvqhehavakfcdlp

SCOP Domain Coordinates for d1uisa_:

Click to download the PDB-style file with coordinates for d1uisa_.
(The format of our PDB-style files is described here.)

Timeline for d1uisa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1uisb_