Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (2 families) |
Family d.22.1.1: Fluorescent proteins [54512] (4 proteins) |
Protein Red fluorescent protein fp61 [102854] (1 species) |
Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [102855] (1 PDB entry) |
Domain d1uisa_: 1uis A: [99431] |
PDB Entry: 1uis (more details), 2 Å
SCOP Domain Sequences for d1uisa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uisa_ d.22.1.1 (A:) Red fluorescent protein fp61 {Sea anemone (Entacmaea quadricolor)} ihmnslikenmrmmvvmegsvngyqfkctgegdgnpymgtqtmrikvveggplpfafdil atsfmsktfikhtkgipdffkqsfpegftwervtryedggvftvmqdtsledgclvyhak vtgvnfpsngavmqkktkgwepntemlypadgglrgysqmalnvdgggylscsfettyrs kktvenfkmpgfhfvdhrlerleesdkemfvvqhehavakfcdlp
Timeline for d1uisa_: