SCOPe 2.06: Domain d1uirb_: 1uir B:

Lineage for d1uirb_ (1uir B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.17: Spermidine synthase [69557] (3 proteins)
   contains additional N-terminal tetramerisation all-beta domain, res. 1-71

6. Protein Spermidine synthase [69558] (6 species)
   polyamine aminopropyltransferase

7. Species Thermus thermophilus [TaxId:274] [102586] (1 PDB entry)

8. Domain d1uirb_: 1uir B: [99430]

Details for d1uirb_

PDB Entry: 1uir, 2 Å

PDB Description: Crystal Structure of Polyamine Aminopropyltransfease from Thermus thermophilus

PDB Compounds: (B:) Polyamine Aminopropyltransferase

SCOPe Domain Sequences for d1uirb_:

Sequence; same for both SEQRES and ATOM records:

>d1uirb_ c.66.1.17 (B:) Spermidine synthase {Thermus thermophilus [TaxId: 274]}
mdygmyffehvtpyetlvrrmerviasgktpfqdyflfeskgfgkvlildkdvqsterde
yiyhetlvhpamlthpepkrvlivgggegatlrevlkhptvekavmvdidgelvevakrh
mpewhqgafddpravlviddaraylerteerydvviidltdpvgednparllytvefyrl
vkahlnpggvmgmqtgmillthhrvhpvvhrtvreafryvrsyknhipgfflnfgfllas
dafdpaafsegviearirernlalrhltapyleamfvlpkdllealeketmvstdqnpfy
vtpegearqapyk

Timeline for d1uirb_:

• d1uirb_ first appeared in SCOP 1.67
  
• d1uirb_ appears in SCOPe 2.05
  
• d1uirb_ appears in SCOPe 2.07
  
• d1uirb_ appears in the current release, SCOPe 2.08