SCOP 1.69: Domain d1uh2a2: 1uh2 A:555-637

Lineage for d1uh2a2 (1uh2 A:555-637)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Maltogenic amylase [51031] (4 species)

7. Species Thermoactinomyces vulgaris, TVAI [TaxId:2026] [75017] (6 PDB entries)

8. Domain d1uh2a2: 1uh2 A:555-637 [99386]
   Other proteins in same PDB: d1uh2a1, d1uh2a3

Details for d1uh2a2

PDB Entry: 1uh2, 2 Å

PDB Description: thermoactinomyces vulgaris r-47 alpha-amylase/malto-hexaose complex

SCOP Domain Sequences for d1uh2a2:

Sequence; same for both SEQRES and ATOM records:

>d1uh2a2 b.71.1.1 (A:555-637) Maltogenic amylase {Thermoactinomyces vulgaris, TVAI}
sfmtlitddtnkiysygrfdnvnriavvlnndsvshtvnvpvwqlsmpngstvtdkitgh
sytvqngmvtvavdghygavlaq

Timeline for d1uh2a2:

• d1uh2a2 first appeared in SCOP 1.67
  
• d1uh2a2 appears in SCOP 1.71
  
• d1uh2a2 appears in the current release, SCOPe 2.08