| Class b: All beta proteins [48724] (180 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
| Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
| Protein Maltogenic amylase [51031] (4 species) |
| Species Thermoactinomyces vulgaris, TVAI [TaxId:2026] [75017] (8 PDB entries) |
| Domain d1uh2a2: 1uh2 A:555-637 [99386] Other proteins in same PDB: d1uh2a1, d1uh2a3 complexed with ca |
PDB Entry: 1uh2 (more details), 2 Å
SCOPe Domain Sequences for d1uh2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uh2a2 b.71.1.1 (A:555-637) Maltogenic amylase {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]}
sfmtlitddtnkiysygrfdnvnriavvlnndsvshtvnvpvwqlsmpngstvtdkitgh
sytvqngmvtvavdghygavlaq
Timeline for d1uh2a2: