Lineage for d1uh2a2 (1uh2 A:555-637)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2419799Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2419800Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2419801Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2420087Protein Maltogenic amylase [51031] (4 species)
  7. 2420091Species Thermoactinomyces vulgaris, TVAI [TaxId:2026] [75017] (8 PDB entries)
  8. 2420096Domain d1uh2a2: 1uh2 A:555-637 [99386]
    Other proteins in same PDB: d1uh2a1, d1uh2a3
    complexed with ca

Details for d1uh2a2

PDB Entry: 1uh2 (more details), 2 Å

PDB Description: thermoactinomyces vulgaris r-47 alpha-amylase/malto-hexaose complex
PDB Compounds: (A:) alpha-amylase I

SCOPe Domain Sequences for d1uh2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uh2a2 b.71.1.1 (A:555-637) Maltogenic amylase {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]}
sfmtlitddtnkiysygrfdnvnriavvlnndsvshtvnvpvwqlsmpngstvtdkitgh
sytvqngmvtvavdghygavlaq

SCOPe Domain Coordinates for d1uh2a2:

Click to download the PDB-style file with coordinates for d1uh2a2.
(The format of our PDB-style files is described here.)

Timeline for d1uh2a2: