SCOP 1.69: Domain d1ufaa1: 1ufa A:413-517

Lineage for d1ufaa1 (1ufa A:413-517)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (7 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (3 families)

5. Family a.8.3.3: Hypothetical protein TT1467, domain 2 [101086] (1 protein)

6. Protein Hypothetical protein TT1467, domain 2 [101087] (1 species)

7. Species Thermus thermophilus [TaxId:274] [101088] (1 PDB entry)

8. Domain d1ufaa1: 1ufa A:413-517 [99329]
   Other proteins in same PDB: d1ufaa2
   structural genomics

Details for d1ufaa1

PDB Entry: 1ufa, 2.2 Å

PDB Description: crystal structure of tt1467 from thermus thermophilus hb8

SCOP Domain Sequences for d1ufaa1:

Sequence; same for both SEQRES and ATOM records:

>d1ufaa1 a.8.3.3 (A:413-517) Hypothetical protein TT1467, domain 2 {Thermus thermophilus}
wlnektldywekvyraegamreaarrgvlpegvlrqamrelllleasdwpflmetgqaea
yareryeeharaffhllkgaspeelraleerdnpfpeadprlylf

Timeline for d1ufaa1:

• d1ufaa1 first appeared in SCOP 1.67
  
• d1ufaa1 appears in SCOP 1.71
  
• d1ufaa1 appears in the current release, SCOPe 2.08