Class a: All alpha proteins [46456] (290 folds) |
Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (4 families) |
Family a.8.3.3: AmyC C-terminal domain-like [101086] (2 proteins) automatically mapped to Pfam PF09210 |
Protein Hypothetical protein TT1467, domain 2 [101087] (1 species) |
Species Thermus thermophilus [TaxId:274] [101088] (1 PDB entry) |
Domain d1ufaa1: 1ufa A:413-517 [99329] Other proteins in same PDB: d1ufaa2 structural genomics |
PDB Entry: 1ufa (more details), 2.2 Å
SCOPe Domain Sequences for d1ufaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ufaa1 a.8.3.3 (A:413-517) Hypothetical protein TT1467, domain 2 {Thermus thermophilus [TaxId: 274]} wlnektldywekvyraegamreaarrgvlpegvlrqamrelllleasdwpflmetgqaea yareryeeharaffhllkgaspeelraleerdnpfpeadprlylf
Timeline for d1ufaa1: