Lineage for d1uf2d2 (1uf2 D:148-300)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459240Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 459241Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
    forms homotrimers
  5. 459242Family b.19.1.1: Top domain of virus capsid protein [49819] (3 proteins)
    this domain is inserted into a multihelical domain
  6. 459264Protein RDV p8, central (top) domain [100924] (2 species)
  7. 459269Species Rice dwarf virus [TaxId:10991] [101592] (1 PDB entry)
  8. 459271Domain d1uf2d2: 1uf2 D:148-300 [99294]
    Other proteins in same PDB: d1uf2a_, d1uf2b_, d1uf2c1, d1uf2d1, d1uf2e1, d1uf2f1, d1uf2g1, d1uf2h1, d1uf2i1, d1uf2j1, d1uf2p1, d1uf2q1, d1uf2r1, d1uf2s1, d1uf2t1

Details for d1uf2d2

PDB Entry: 1uf2 (more details), 3.5 Å

PDB Description: the atomic structure of rice dwarf virus (rdv)

SCOP Domain Sequences for d1uf2d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uf2d2 b.19.1.1 (D:148-300) RDV p8, central (top) domain {Rice dwarf virus}
sepiepcklfrsvagqtgnipmmgilatppaaqqqpffvaerrrilfgirsnaaipagay
qfvvpawasvlsvtgayvyftnsffgtiiagvtatataadaattftvptdannlpvqtds
rlsfslgggninlelgvaktgfcvaiegeftil

SCOP Domain Coordinates for d1uf2d2:

Click to download the PDB-style file with coordinates for d1uf2d2.
(The format of our PDB-style files is described here.)

Timeline for d1uf2d2: