SCOPe 2.07: Domain d1uexc_: 1uex C:

Lineage for d1uexc_ (1uex C:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (6 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)

6. Protein von Willebrand factor A1 domain, vWA1 [53306] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53307] (10 PDB entries)

8. Domain d1uexc_: 1uex C: [99284]
   Other proteins in same PDB: d1uexa_, d1uexb_
   complexed with bitiscetin

Details for d1uexc_

PDB Entry: 1uex, 2.85 Å

PDB Description: Crystal structure of von Willebrand Factor A1 domain complexed with snake venom bitiscetin

PDB Compounds: (C:) von willebrand factor

SCOPe Domain Sequences for d1uexc_:

Sequence; same for both SEQRES and ATOM records:

>d1uexc_ c.62.1.1 (C:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]}
epplhdfycsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavveyhd
gshayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasriall
lmasqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssv
deleqqrdeivsylcdlapeap

Timeline for d1uexc_:

• d1uexc_ first appeared in SCOP 1.67
  
• d1uexc_ appears in SCOPe 2.06
  
• d1uexc_ appears in the current release, SCOPe 2.08