Lineage for d1udwa_ (1udw A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866582Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (6 proteins)
  6. 2866606Protein Uridine-cytidine kinase 2 [102360] (1 species)
  7. 2866607Species Human (Homo sapiens) [TaxId:9606] [102361] (10 PDB entries)
  8. 2866614Domain d1udwa_: 1udw A: [99226]
    complexed with ctp

Details for d1udwa_

PDB Entry: 1udw (more details), 2.6 Å

PDB Description: Crystal structure of human uridine-cytidine kinase 2 complexed with a feedback-inhibitor, CTP
PDB Compounds: (A:) Uridine-cytidine kinase 2

SCOPe Domain Sequences for d1udwa_:

Sequence, based on SEQRES records: (download)

>d1udwa_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}
epfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkakalk
gqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegil
afysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefcl
ptkkyadviiprgadnlvainlivqhiqdiln

Sequence, based on observed residues (ATOM records): (download)

>d1udwa_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}
epfligvsggtasgkssvcakivqllqkqvvilsqdsfyrvltseqkakalkgqfnfdhp
dafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegilafysqevr
dlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefclptkkyadv
iiprgadnlvainlivqhiqdiln

SCOPe Domain Coordinates for d1udwa_:

Click to download the PDB-style file with coordinates for d1udwa_.
(The format of our PDB-style files is described here.)

Timeline for d1udwa_: