SCOPe 2.08: Domain d1udva_: 1udv A:

Lineage for d1udva_ (1udv A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.68: IF3-like [55199] (8 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.6: AlbA-like [82704] (3 families)

5. Family d.68.6.1: DNA-binding protein AlbA [82705] (2 proteins)

6. Protein DNA-binding protein AlbA [82706] (4 species)
   an archaeal chromatin protein modulated by acetylation, a Sir2 substrate

7. Species Sulfolobus solfataricus, Sso10b2 [TaxId:2287] [103058] (3 PDB entries)
   gene SSO6877 (AlbA2)

8. Domain d1udva_: 1udv A: [99224]
   complexed with zn

Details for d1udva_

PDB Entry: 1udv, 1.85 Å

PDB Description: Crystal structure of the hyperthermophilic archaeal dna-binding protein Sso10b2 at 1.85 A

PDB Compounds: (A:) DNA binding protein sso10b

SCOPe Domain Sequences for d1udva_:

Sequence; same for both SEQRES and ATOM records:

>d1udva_ d.68.6.1 (A:) DNA-binding protein AlbA {Sulfolobus solfataricus, Sso10b2 [TaxId: 2287]}
teklneivvrktknvedhvldvivlfnqgidevilkgtgreiskavdvynslkdrlgdgv
qlvnvqtgsevrdrrrisyillrlkrvy

Timeline for d1udva_:

• d1udva_ first appeared in SCOP 1.67
  
• d1udva_ appears in SCOPe 2.07