Lineage for d1udva_ (1udv A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 413649Fold d.68: IF3-like [55199] (7 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 413768Superfamily d.68.6: DNA-binding protein AlbA [82704] (1 family) (S)
  5. 413769Family d.68.6.1: DNA-binding protein AlbA [82705] (1 protein)
  6. 413770Protein DNA-binding protein AlbA [82706] (4 species)
    an archaeal chromatin protein modulated by acetylation, a Sir2 substrate
  7. 413781Species Archaeon Sulfolobus solfataricus, Sso10b2 [TaxId:2287] [103058] (1 PDB entry)
    gene SSO6877 (AlbA2)
  8. 413782Domain d1udva_: 1udv A: [99224]

Details for d1udva_

PDB Entry: 1udv (more details), 1.85 Å

PDB Description: Crystal structure of the hyperthermophilic archaeal dna-binding protein Sso10b2 at 1.85 A

SCOP Domain Sequences for d1udva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1udva_ d.68.6.1 (A:) DNA-binding protein AlbA {Archaeon Sulfolobus solfataricus, Sso10b2}
teklneivvrktknvedhvldvivlfnqgidevilkgtgreiskavdvynslkdrlgdgv
qlvnvqtgsevrdrrrisyillrlkrvy

SCOP Domain Coordinates for d1udva_:

Click to download the PDB-style file with coordinates for d1udva_.
(The format of our PDB-style files is described here.)

Timeline for d1udva_: