Lineage for d1udla_ (1udl A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665103Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 665104Family b.34.2.1: SH3-domain [50045] (38 proteins)
  6. 665298Protein Intersectin 2 (KIAA1256) [101669] (1 species)
  7. 665299Species Human (Homo sapiens) [TaxId:9606] [101670] (5 PDB entries)
  8. 665301Domain d1udla_: 1udl A: [99212]
    structural genomics; fifth SH3 domain

Details for d1udla_

PDB Entry: 1udl (more details)

PDB Description: the solution structure of the fifth sh3 domain of intersectin 2 (kiaa1256)
PDB Compounds: (A:) Intersectin 2

SCOP Domain Sequences for d1udla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]}
gssgssgqkgwfpashvkllgpsseratpafhpvcqviamydyaannedelsfskgqlin
vmnkddpdwwqgeingvtglfpsnyvkmttdssgpssg

SCOP Domain Coordinates for d1udla_:

Click to download the PDB-style file with coordinates for d1udla_.
(The format of our PDB-style files is described here.)

Timeline for d1udla_: