Class b: All beta proteins [48724] (165 folds) |
Fold b.34: SH3-like barrel [50036] (18 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (1 family) |
Family b.34.2.1: SH3-domain [50045] (38 proteins) |
Protein Intersectin 2 (KIAA1256) [101669] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101670] (5 PDB entries) |
Domain d1udla_: 1udl A: [99212] structural genomics; fifth SH3 domain |
PDB Entry: 1udl (more details)
SCOP Domain Sequences for d1udla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} gssgssgqkgwfpashvkllgpsseratpafhpvcqviamydyaannedelsfskgqlin vmnkddpdwwqgeingvtglfpsnyvkmttdssgpssg
Timeline for d1udla_: