PDB entry 1udl

View 1udl on RCSB PDB site
Description: The solution structure of the fifth SH3 domain of intersectin 2 (KIAA1256)
Class: endocytosis/exocytosis
Keywords: BETA BARREL, SH3 DOMAIN, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2003-05-01, released 2003-11-01
The last revision prior to the SCOP 1.73 freeze date was dated 2003-11-01, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Intersectin 2
  Species: HOMO SAPIENS
  Gene: Kazusa cDNA hh15293
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9NZM3 (7-91)
    • cloning artifact (0-6)
    • cloning artifact (92-97)
  Domains in SCOP 1.73: d1udla_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1udlA (A:)
  gssgssgqkgwfpashvkllgpsseratpafhpvcqviamydyaannedelsfskgqlin
  vmnkddpdwwqgeingvtglfpsnyvkmttdssgpssg