SCOPe 2.08: Domain d1ucjb_: 1ucj B:

Lineage for d1ucjb_ (1ucj B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)

6. Protein RNase Sa [53935] (1 species)

7. Species Streptomyces aureofaciens [TaxId:1894] [53936] (22 PDB entries)
   Uniprot P05798

8. Domain d1ucjb_: 1ucj B: [99178]
   complexed with so4; mutant

Details for d1ucjb_

PDB Entry: 1ucj, 1.81 Å

PDB Description: mutants of rnase sa

PDB Compounds: (B:) guanyl-specific ribonuclease sa

SCOPe Domain Sequences for d1ucjb_:

Sequence; same for both SEQRES and ATOM records:

>d1ucjb_ d.1.1.2 (B:) RNase Sa {Streptomyces aureofaciens [TaxId: 1894]}
dvsgtvclsalppeatdtlnliasdgpfpysqdgvtfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqtc

Timeline for d1ucjb_:

• d1ucjb_ first appeared in SCOP 1.67
  
• d1ucjb_ appears in SCOPe 2.07