Lineage for d1ucjb_ (1ucj B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2494618Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2494619Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2494620Family d.1.1.2: Bacterial ribonucleases [81307] (6 protein domains)
  6. 2494773Protein RNase Sa [53935] (1 species)
  7. 2494774Species Streptomyces aureofaciens [TaxId:1894] [53936] (22 PDB entries)
    Uniprot P05798
  8. 2494803Domain d1ucjb_: 1ucj B: [99178]
    complexed with so4; mutant

Details for d1ucjb_

PDB Entry: 1ucj (more details), 1.81 Å

PDB Description: Mutants of RNase Sa
PDB Compounds: (B:) guanyl-specific ribonuclease sa

SCOPe Domain Sequences for d1ucjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ucjb_ d.1.1.2 (B:) RNase Sa {Streptomyces aureofaciens [TaxId: 1894]}
dvsgtvclsalppeatdtlnliasdgpfpysqdgvtfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqtc

SCOPe Domain Coordinates for d1ucjb_:

Click to download the PDB-style file with coordinates for d1ucjb_.
(The format of our PDB-style files is described here.)

Timeline for d1ucjb_: