PDB entry 1ucj

View 1ucj on RCSB PDB site
Description: Mutants of RNase Sa
Class: hydrolase
Keywords: Protein Stability, Hydrogen Bond, Burial Polar, hydrolase
Deposited on 2003-04-15, released 2003-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.185
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guanyl-specific ribonuclease sa
    Species: Streptomyces aureofaciens [TaxId:1894]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05798 (0-95)
      • engineered (35)
    Domains in SCOPe 2.07: d1ucja_
  • Chain 'B':
    Compound: guanyl-specific ribonuclease sa
    Species: Streptomyces aureofaciens [TaxId:1894]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05798 (0-95)
      • engineered (35)
    Domains in SCOPe 2.07: d1ucjb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ucjA (A:)
    dvsgtvclsalppeatdtlnliasdgpfpysqdgvtfqnresvlptqsygyyheytvitp
    gartrgtrriitgeatqedyytgdhyatfslidqtc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ucjB (B:)
    dvsgtvclsalppeatdtlnliasdgpfpysqdgvtfqnresvlptqsygyyheytvitp
    gartrgtrriitgeatqedyytgdhyatfslidqtc