Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (7 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.6: Lysine biosynthesis enzyme LysX, N-terminal domain [102284] (1 protein) |
Protein Lysine biosynthesis enzyme LysX, N-terminal domain [102285] (1 species) |
Species Thermus thermophilus [TaxId:274] [102286] (2 PDB entries) |
Domain d1uc9b1: 1uc9 B:1-88 [99171] Other proteins in same PDB: d1uc9a2, d1uc9b2 complexed with adp |
PDB Entry: 1uc9 (more details), 2.38 Å
SCOP Domain Sequences for d1uc9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uc9b1 c.30.1.6 (B:1-88) Lysine biosynthesis enzyme LysX, N-terminal domain {Thermus thermophilus [TaxId: 274]} mlailydrirpdermlferaealglpykkvyvpalpmvlgerpkelegvtvalercvsqs rglaaaryltalgipvvnrpevieacgd
Timeline for d1uc9b1: