Lineage for d1uc9b1 (1uc9 B:1-88)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 580550Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 580551Superfamily c.30.1: PreATP-grasp domain [52440] (6 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 580733Family c.30.1.6: Lysine biosynthesis enzyme LysX, N-terminal domain [102284] (1 protein)
  6. 580734Protein Lysine biosynthesis enzyme LysX, N-terminal domain [102285] (1 species)
  7. 580735Species Thermus thermophilus [TaxId:274] [102286] (2 PDB entries)
  8. 580739Domain d1uc9b1: 1uc9 B:1-88 [99171]
    Other proteins in same PDB: d1uc9a2, d1uc9b2
    complexed with adp

Details for d1uc9b1

PDB Entry: 1uc9 (more details), 2.38 Å

PDB Description: Crystal structure of a lysine biosynthesis enzyme, Lysx, from thermus thermophilus HB8

SCOP Domain Sequences for d1uc9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uc9b1 c.30.1.6 (B:1-88) Lysine biosynthesis enzyme LysX, N-terminal domain {Thermus thermophilus}
mlailydrirpdermlferaealglpykkvyvpalpmvlgerpkelegvtvalercvsqs
rglaaaryltalgipvvnrpevieacgd

SCOP Domain Coordinates for d1uc9b1:

Click to download the PDB-style file with coordinates for d1uc9b1.
(The format of our PDB-style files is described here.)

Timeline for d1uc9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uc9b2