SCOPe 2.04: Domain d1uc7a_: 1uc7 A:

Lineage for d1uc7a_ (1uc7 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) [102435] (2 species)

7. Species Escherichia coli [TaxId:562] [102436] (5 PDB entries)

8. Domain d1uc7a_: 1uc7 A: [99163]
   disulfide-linked complex with the N-terminal domain

Details for d1uc7a_

PDB Entry: 1uc7, 1.9 Å

PDB Description: Crystal structure of DsbDgamma

PDB Compounds: (A:) Thiol:disulfide interchange protein dsbD

SCOPe Domain Sequences for d1uc7a_:

Sequence; same for both SEQRES and ATOM records:

>d1uc7a_ c.47.1.1 (A:) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]}
aqtqthlnftqiktvdelnqalveakgkpvmldlyadwcvackefekytfsdpqvqkala
dtvllqanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlr
drqp

Timeline for d1uc7a_:

• d1uc7a_ first appeared in SCOP 1.67
  
• d1uc7a_ appears in SCOPe 2.03
  
• d1uc7a_ appears in SCOPe 2.05
  
• d1uc7a_ appears in the current release, SCOPe 2.08