Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.261: Hypothetical protein PH1602 [103364] (1 superfamily) complex alpha+beta fold; contains a region of similarity to the ferredoxin-like fold |
Superfamily d.261.1: Hypothetical protein PH1602 [103365] (1 family) |
Family d.261.1.1: Hypothetical protein PH1602 [103366] (1 protein) |
Protein Hypothetical protein PH1602 [103367] (1 species) |
Species Archaeon Pyrococcus horikoshii [TaxId:53953] [103368] (1 PDB entry) |
Domain d1uc2b_: 1uc2 B: [99162] structural genomics |
PDB Entry: 1uc2 (more details), 2.15 Å
SCOP Domain Sequences for d1uc2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uc2b_ d.261.1.1 (B:) Hypothetical protein PH1602 {Archaeon Pyrococcus horikoshii} vvplkridkirweipkfdkrmrvpgrvyadevllekmkndrtleqatnvamlpgiykysi vmpdghqgygfpiggvaafdvkegvispggigydincgvrlirtnltekevrprikqlvd tlfknvpsgvgsqgriklhwtqiddvlvdgakwavdngygwerdlerleeggrmegadpe avsqrakqrgapqlgslgsgnhflevqvvdkifdpevakayglfegqvvvmvhtgsrglg hqvasdylrimerairkyripwpdrelvsvpfqseegqryfsamkaaanfawanrqmith wvresfqevfkqdpegdlgmdivydvahnigkveehevdgkrvkvivhrkgatrafppgh eavprlyrdvgqpvlipgsmgtasyilagtegamketfgstchgagrvlsrkaatrqyrg drirqellnrgiyvraasmrvvaeeapgayknvdnvvkvvseagiaklvarmrpigvakg
Timeline for d1uc2b_: