Lineage for d1uc2b_ (1uc2 B:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 423553Fold d.261: Hypothetical protein PH1602 [103364] (1 superfamily)
    complex alpha+beta fold; contains a region of similarity to the ferredoxin-like fold
  4. 423554Superfamily d.261.1: Hypothetical protein PH1602 [103365] (1 family) (S)
  5. 423555Family d.261.1.1: Hypothetical protein PH1602 [103366] (1 protein)
  6. 423556Protein Hypothetical protein PH1602 [103367] (1 species)
  7. 423557Species Archaeon Pyrococcus horikoshii [TaxId:53953] [103368] (1 PDB entry)
  8. 423559Domain d1uc2b_: 1uc2 B: [99162]
    structural genomics
    complexed with so4, suc

Details for d1uc2b_

PDB Entry: 1uc2 (more details), 2.15 Å

PDB Description: hypothetical extein protein of ph1602 from pyrococcus horikoshii

SCOP Domain Sequences for d1uc2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uc2b_ d.261.1.1 (B:) Hypothetical protein PH1602 {Archaeon Pyrococcus horikoshii}
vvplkridkirweipkfdkrmrvpgrvyadevllekmkndrtleqatnvamlpgiykysi
vmpdghqgygfpiggvaafdvkegvispggigydincgvrlirtnltekevrprikqlvd
tlfknvpsgvgsqgriklhwtqiddvlvdgakwavdngygwerdlerleeggrmegadpe
avsqrakqrgapqlgslgsgnhflevqvvdkifdpevakayglfegqvvvmvhtgsrglg
hqvasdylrimerairkyripwpdrelvsvpfqseegqryfsamkaaanfawanrqmith
wvresfqevfkqdpegdlgmdivydvahnigkveehevdgkrvkvivhrkgatrafppgh
eavprlyrdvgqpvlipgsmgtasyilagtegamketfgstchgagrvlsrkaatrqyrg
drirqellnrgiyvraasmrvvaeeapgayknvdnvvkvvseagiaklvarmrpigvakg

SCOP Domain Coordinates for d1uc2b_:

Click to download the PDB-style file with coordinates for d1uc2b_.
(The format of our PDB-style files is described here.)

Timeline for d1uc2b_: