SCOPe 2.05: Domain d1t3ha_: 1t3h A:

Lineage for d1t3ha_ (1t3h A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Dephospho-CoA kinase [75187] (4 species)

7. Species Escherichia coli [TaxId:562] [82394] (5 PDB entries)

8. Domain d1t3ha_: 1t3h A: [99117]
   structural genomics; NESG target ER57
   complexed with so4

Details for d1t3ha_

PDB Entry: 1t3h, 2.5 Å

PDB Description: X-ray Structure of Dephospho-CoA Kinase from E. coli Norteast Structural Genomics Consortium Target ER57

PDB Compounds: (A:) dephospho-coa kinase

SCOPe Domain Sequences for d1t3ha_:

Sequence; same for both SEQRES and ATOM records:

>d1t3ha_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]}
mryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmia
adgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvensl
ykkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnngapd
aiasdvarlhahylqlasqfvsqekpe

Timeline for d1t3ha_:

• d1t3ha_ first appeared in SCOP 1.67
  
• d1t3ha_ appears in SCOPe 2.04
  
• d1t3ha_ is called d1t3ha1 in SCOPe 2.06
  
• d1t3ha_ appears in the current release, SCOPe 2.08, called d1t3ha1