Lineage for d1t3ha1 (1t3h A:1-206)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2123294Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2123551Protein Dephospho-CoA kinase [75187] (4 species)
  7. 2123552Species Escherichia coli [TaxId:562] [82394] (5 PDB entries)
  8. 2123565Domain d1t3ha1: 1t3h A:1-206 [99117]
    Other proteins in same PDB: d1t3ha2, d1t3hb2, d1t3hc2
    structural genomics; NESG target ER57
    complexed with so4

Details for d1t3ha1

PDB Entry: 1t3h (more details), 2.5 Å

PDB Description: X-ray Structure of Dephospho-CoA Kinase from E. coli Norteast Structural Genomics Consortium Target ER57
PDB Compounds: (A:) dephospho-coa kinase

SCOPe Domain Sequences for d1t3ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3ha1 c.37.1.1 (A:1-206) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]}
mryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmia
adgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvensl
ykkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnngapd
aiasdvarlhahylqlasqfvsqekp

SCOPe Domain Coordinates for d1t3ha1:

Click to download the PDB-style file with coordinates for d1t3ha1.
(The format of our PDB-style files is described here.)

Timeline for d1t3ha1: