Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.129: MCP/YpsA-like [102404] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567 |
Superfamily c.129.1: MCP/YpsA-like [102405] (3 families) |
Family c.129.1.1: MoCo carrier protein-like [102406] (6 proteins) Pfam PF03641 |
Protein Hypothetical protein YvdD [102409] (1 species) |
Species Bacillus subtilis [TaxId:1423] [102410] (1 PDB entry) |
Domain d1t35f_: 1t35 F: [99113] structural genomics; NYSGRC target T833 complexed with so4 |
PDB Entry: 1t35 (more details), 2.72 Å
SCOPe Domain Sequences for d1t35f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t35f_ c.129.1.1 (F:) Hypothetical protein YvdD {Bacillus subtilis [TaxId: 1423]} mkticvfagsnpggneaykrkaaelgvymaeqgiglvyggsrvglmgtiadaimenggta igvmpsglfsgevvhqnltelievngmherkakmseladgfismpggfgtyeelfevlcw aqigihqkpiglynvngyfepmmkmvkysiqegfsneshlklihsssrpdelieqmqnys ypil
Timeline for d1t35f_: