Lineage for d1t0ub_ (1t0u B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2495644Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2495645Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2496076Protein Uridine phosphorylase [53176] (6 species)
  7. 2496077Species Escherichia coli [TaxId:562] [53177] (16 PDB entries)
  8. 2496099Domain d1t0ub_: 1t0u B: [99065]

Details for d1t0ub_

PDB Entry: 1t0u (more details), 2.2 Å

PDB Description: Crystal structure of E.coli uridine phosphorylase at 2.2 A resolution (Type-A Native)
PDB Compounds: (B:) Uridine phosphorylase

SCOPe Domain Sequences for d1t0ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0ub_ c.56.2.1 (B:) Uridine phosphorylase {Escherichia coli [TaxId: 562]}
ksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpv
ivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslh
faplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkg
smeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshav
kivveaarrll

SCOPe Domain Coordinates for d1t0ub_:

Click to download the PDB-style file with coordinates for d1t0ub_.
(The format of our PDB-style files is described here.)

Timeline for d1t0ub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1t0ua_