Lineage for d1syrf_ (1syr F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876194Protein Thioredoxin [52835] (16 species)
  7. 2876385Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [102431] (1 PDB entry)
  8. 2876391Domain d1syrf_: 1syr F: [99033]
    structural genomics

Details for d1syrf_

PDB Entry: 1syr (more details), 2.95 Å

PDB Description: initial structural analysis of plasmodium falciparum thioredoxin
PDB Compounds: (F:) thioredoxin

SCOPe Domain Sequences for d1syrf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1syrf_ c.47.1.1 (F:) Thioredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
vkivtsqaefdsiisqnelvivdffaewcgpckriapfyeecsktytkmvfikvdvdevs
evtekenitsmptfkvykngssvdtllgandsalkqliekya

SCOPe Domain Coordinates for d1syrf_:

Click to download the PDB-style file with coordinates for d1syrf_.
(The format of our PDB-style files is described here.)

Timeline for d1syrf_: