Lineage for d1su4a3 (1su4 A:361-599)
- Root: SCOP 1.71
Class d: Alpha and beta proteins (a+b) [53931] (286 folds) 
Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily)
unusual fold; core: beta-alpha(2)-beta(3)-alpha(2)-beta(2); 6-stranded antiparallel beta-sheet, order: 165432Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family) 
Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (3 proteins) Protein Calcium ATPase [81658] (1 species) Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81657] (9 PDB entries) 
Domain d1su4a3: 1su4 A:361-599 [98995]
Other proteins in same PDB: d1su4a1, d1su4a2, d1su4a4
complexed with ca, na
Details for d1su4a3
PDB Entry: 1su4 (more details), 2.4 Å
PDB Description: crystal structure of calcium atpase with two bound calcium ions
SCOP Domain Sequences for d1su4a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1su4a3 d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus)}
msvckmfiidkvdgdfcslnefsitgstyapegevlkndkpirsgqfdglvelaticalc
ndssldfnetkgvyekvgeatetalttlvekmnvfntevrnlskveranacnsvirqlmk
keftlefsrdrksmsvycspakssraavgnkmfvkgapegvidrcnyvrvgttrvpmtgp
vkekilsvikewgtgrdtlrclalatrdtppkreemvlddssrfmeyetdltfvgvvgm
SCOP Domain Coordinates for d1su4a3:
Click to download the PDB-style file with coordinates for d1su4a3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1su4a3:
- d1su4a3 first appeared in SCOP 1.67
- d1su4a3 appears in SCOP 1.69
- d1su4a3 appears in SCOP 1.73
- d1su4a3 appears in the current release, SCOPe 2.08
View in 3D
