Lineage for d1su4a3 (1su4 A:361-599)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 740349Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily)
    unusual fold; core: beta-alpha(2)-beta(3)-alpha(2)-beta(2); 6-stranded antiparallel beta-sheet, order: 165432
  4. 740350Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family) (S)
  5. 740351Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (4 proteins)
  6. 740352Protein Calcium ATPase [81658] (1 species)
  7. 740353Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81657] (9 PDB entries)
  8. 740358Domain d1su4a3: 1su4 A:361-599 [98995]
    Other proteins in same PDB: d1su4a1, d1su4a2, d1su4a4
    complexed with ca, na

Details for d1su4a3

PDB Entry: 1su4 (more details), 2.4 Å

PDB Description: crystal structure of calcium atpase with two bound calcium ions
PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOP Domain Sequences for d1su4a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1su4a3 d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
msvckmfiidkvdgdfcslnefsitgstyapegevlkndkpirsgqfdglvelaticalc
ndssldfnetkgvyekvgeatetalttlvekmnvfntevrnlskveranacnsvirqlmk
keftlefsrdrksmsvycspakssraavgnkmfvkgapegvidrcnyvrvgttrvpmtgp
vkekilsvikewgtgrdtlrclalatrdtppkreemvlddssrfmeyetdltfvgvvgm

SCOP Domain Coordinates for d1su4a3:

Click to download the PDB-style file with coordinates for d1su4a3.
(The format of our PDB-style files is described here.)

Timeline for d1su4a3: